PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010532126.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 360aa    MW: 39753.2 Da    PI: 7.7555
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010532126.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-32224279156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010532126.1 224 KQRRCWSPELHRRFLNALQQLGGSNAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.406221281IPR017930Myb domain
SuperFamilySSF466891.55E-18221282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28222282IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-28224280IPR006447Myb domain, plants
PfamPF002491.4E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MVENVDMDVD CAQKMQRCHE YVEALEEERK KIHVFQRELP LCLELVTHAI EACRRELSGT  60
SSDNMYGQSD CSDQTTSECA GTGPVFEEFL PIKRISSCGE DGEHESREPE NDGDLKIANN  120
TGNDTDKKKS DWLRSVQLWN QSPDPPSKEA AETTLVVEVK RNGGAFQPFQ KEKKPLPKSN  180
KQPVKTTSSP PAPTASSSTA ETGGGKRVSE KVEEQQHQTQ THRKQRRCWS PELHRRFLNA  240
LQQLGGSNAA TPKQIRELMK VDGLTNDEVK SHLQKYRLHK RRPATHGGGN PQQPQLVVVG  300
GIWPLPQPPP PADATDGVNA AAQRSSPSPK RSEDRIISSR CSSLATSSST RTTTTSSPVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010532126.10.0PREDICTED: uncharacterized protein LOC104808201
TrEMBLV4KM611e-120V4KM61_EUTSA; Uncharacterized protein
STRINGPOPTR_0008s11630.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-105G2-like family protein